TB-500 (Thymosin Beta-4)

Description

TB-500 (Thymosin Beta-4) is a synthetic research peptide supplied for controlled laboratory studies. Researchers use this compound in structured research focused on peptide behavior and interaction patterns.

• Synthetic peptide used in laboratory research settings
• Supports studies focused on peptide signaling and interaction behavior
• Suitable for controlled and repeatable research workflows

QUICK SPECS

• Form: Lyophilized white powder

• Net Peptide Content: 10 mg per vial

• Quantity: 1 vial

• Appearance: White to off-white lyophilizate

• Reconstitution: Bacteriostatic or sterile water (added by the end researcher)

• Purity: ≥99% by HPLC

• Identity: MS-verified (per COA)

• Storage: Protect from light

IDENTITY BASICS

• Compound: TB-500 (Thymosin Beta-4 / Tβ4)

• Synonyms: Thymosin Beta-4; Tβ4; TMSB4X protein

• Class: β-thymosin family; G-actin sequestering peptide; 43 amino acids

• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES (Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Thr-Leu-Pro-Thr-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser)

• Formula / M.W.: C₂₁₂H₃₅₀N₅₆O₇₈S, ~4963.44 g/mol

• Active fragment: Ac-SDKP (N-terminal tetrapeptide, formed via prolyl oligopeptidase cleavage)

• CAS: 77591-33-4

⚠️ Disclaimer

• This product is intended for laboratory research use only.
• Not for human or veterinary use.
• Not approved for diagnostic, therapeutic, or medical applications.
• Handle using appropriate laboratory safety procedures and personal protective equipment.

COA Verification Notice: Even if the vial label or product image states a certain concentration, always go by the COA for the true verified value. We reference the COA to determine the verified concentration and purity of each product, regardless of what the label or product image indicates.